GenomeNet

>tr:K7ZRM7_9CAUD [K7ZRM7] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MGKYSEIIAATQAEDAQARARAAGITAPQVEPDAMGRAMRLADQRGLPPGVVADNLPEYD
QQQQLDALGDAASASPALARWLGDPNHTALSKDDTGVLAGLGRQFNSGLLSAKETLPWLP
LPQSALDLDKERKAAAARGPQMMASPDPSWFSELVGKFQSGWEQGKAGAGLLPMPDLGSA
SSRAIEEQVARGLGYQDAANYDATRTAVYVADQQRRAQAADVETAATAAGFQEIADAEKT
KDTGKIARAVVTNPRAVMAVVAQSLGNTAPQLALSAAMPASRVVAGVTAGTGSFATEQGM
TILDVMGDAGVETSDPAAVSAFLRNKPAMEKARQKALTRGVAVGTFDALTAGFAGRLLAN
SRRTAASIGSRVVGEGLVQAGGGAAGEATAQLASEGKITSQSDILLEAAAEVPTFLAEGR
GQIAEARRAAMHNADRFDAHQEQRAISDLVNLASQSKTRERSATRFESLIRDMTSEGEDT
IYLSADGAQRLFQSANSEGGPDLGALVDADALREAIATGGEVAIPLAKYATLVTPELHAA
VADQVRLQPGGRHDLPAVSSEEIQQAIDQGLAEAQQQDARENGPAGQVYDDVVGQLLSRQ
DEQLARQNASVVQSVYRNLAERVGTDAWTLYQQFKIRIPGATTDTRARPRGVDIDVDPFL
DALRSGKMPTDREIYGDTLVSALHAAGGLSDSGGELANMDAAKARPGLVNNLAGMSLDDA
LVWAYQEGFITQAPTNQQEGSYDADAPDINTLLDLLAQDLGGNPVYRPAAMNAERATFRD
RAQSLQDELDQRGIDLQQADNATARQALGYANRMLEQGQPVEPDAVDYAVRDLVAGPSGR
PESAATRALVDQAVADGDLAKMLQGIAAQEGIDADQAALALRLAEITPDLNVTMVAAPAN
ANAAGIYNNTTNEIWIHQAVPSVVLHEVLHGVTSAMMTSPTLRRSNATVARAVAEFNDLL
GAAQAHFAGMETDGADVPAALRATLQDPRGPLSNIKELLTYGMTDKRFQEWLATVPAPAG
REESRTAWQWFKDAIATMLGVTGQERTALDALIESTSDLVDFAQANPRAANFAQMSEANR
LGAPITDAAAAQGGPAEAFRGVTREQFLGEPRITSNTNAADLRPRALRELDAVDSVPFGD
GDLTAKYSDGSAAVFDGDKVVASYNFGDTLVVDRAYRRRGIGEELVYQWRTRNPQASVAR
ERTKASQALQEKVWDRIQSELAADPRTLNQGGEKPRGAVTFEGVPGARVFNIELLKGMDA
STFMHEMGHVYLEVLNDLAARDGAPAQITNDMATLNAWLGREAGTAFTVDQHEQFARGFE
AYLREGRAPSSALRRTFAAFKVWLTALYRSVRSLNVELTDDVRNVMDRIVASDAEIEDAR
AGQYQGALIADGMAVGMTFEQLQAYNEAVNAARADAEATVAAEVLLAERREQQAWYNREK
REVRTQVLEEVRNLPVYRAQRLLRNGKLPNGDLAPDELRVKLSKDELLDKFGQSFLRNLV
GMYSVEGGVRADDAAAIYGFGSGRELIESLVNAPRLADAVASETDARMKDRHPDPMTDGT
LPDRAMIAAHRDRQADVMVREIRALEQHVNGRQVSQAAVIKGVARQIIQDKKLRHLQPAT
YRSAEAKAGREAFEAAAKQDWGSALAARRRQLLNFELFREAVRARDEAARTAKYLAKFSE
TKTRARLGKAGADYLDQVDGLLDRFDFRKISDKAADRRSSLATWIEVQAQKGIDVNLPPK
IMDEAFTIPYREMTVADLATLRDAIRSIDHLARLKGKLLLAGEVRDAAEVDAAMAASLAA
AHAARPVTTGDRGPKDKLRQAFMQGRVIQATATDMARELDGFKDQGAIWMNTVGVMRDAV
NNRLNPALQQAQDDLAKVYVKHYTKAEIRGFSERVPMPEVNGDLWSKSRLLGLALNWGNA
GNREAILTQARGRMSSEQVNALLSKLDSRDWAFVEDVWRLIDAQWPAIAEAQKRRTGLVP
ERVQASAFTVQTSDGKTLQIPGGYYPLKYESDSVKTMKDEADDFYNSIRTGRTAKAATRN
GHTIERVGSGGRTVRLDTGVVQQHLRDVLRDVHLGDAVNYVHNVLNGQEFKEAVDSTGMQ
EYRQALEVWLKDAAAGEIGPRVWHERAMRAARQNFTASVLTFKVTSALLQLSGVVPTIVT
IGQGHTMAGIGQYLGKPRAMTRYVREASPYMDSRLRTHIEAVQTVMDAEAGRFAAGKAAS
IRFGYWMIGRVQGLVDTVTWLAAEQAGMAKFGNDVARARAYADDVVTRAQGSGEFIDKSP
LQRGTLGDNVRQTEWIKATTALQGYMIAKGNLAYEQTRKANLRNPRQAMKWAADMVMLFS
VEGLLTAALTAKLPKDDDDDGLWDDLGEWAIKDALSTFFGVIPGGGVLVDQFRGYDSSGV
VAGAWRAYAELLEKVTPGEDGEVNLDKGVAKAAVSAAGVTLGLPSTQVNKTIDAIAARAD
GRDVSPYEYLTGPKKESK

BLAST