GenomeNet

>tr:K9SCJ0_9CYAN [K9SCJ0] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000256|HAMAP-Rule:MF_00377, ECO:0000256|RuleBase:RU000577, ECO:0000256|SAAS:SAAS01081161};
MDISKDTLWTMVLEYLEGEVSRPALESWIKTALPEELTPEKFVLRTPHSFARNWLFKYYY
HRLKEVVAEILGYTVEVQILTAQQLDSNAVEMPEDVYGHKDIILLSDDTPTEITAAGANN
LVRAGNSNSNGSDRQDSPSATNASNGSNSNGVRTGKINPKYTFSRFVVGATNRMAHAAAL
AVAESPGREFNPLFLCGGVGLGKTHLMQAIAHYRLEISTDQKIFYVSTEQFTNDLISAIR
QDSMQAFREHYRDVDMILVDDIQFIEGKEYTQEEFFHTFNTLYESGKQIILASDRPPAQI
PRLQERLCSRFSMGLIADVQVPDLETRMAILQKKAEYENLRIPSEVIHYIAASYTSNIRE
LEGALVRAVTYISISGLPMTVDNVSPVLNAPKEPVEIAPAQVVDLVAAYFEVEAEAMRGS
SRKRTISLARQVAMFLMRQHTSLSLPKIGDELGGKDHTTVMYSCDKIAQQQEKDPEMAQA
LREISDRIYHIAKEGDAPAKSIEGGNRK

BLAST