GenomeNet

>tr:L0EUW8_LIBCB [L0EUW8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AGA64181.1};
MKKSYLLLYPICFLFSIAASSVPPEVIVYAKQKETGSIFSPHKFTYTKDFDVTVVNFSQG
EIDLSKYCFKAMLGMKEFNVDTIDEKLASKKLKNGERLRGVVVFSSNNSDVTQANIVQLT
DKCKKN

BLAST