GenomeNet

>tr:L1IK07_GUITC [L1IK07] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EKX36254.1, ECO:0000313|EnsemblProtists:EKX36254};
MSVNWVGSKARASAGMPDTERKHQNDMLSSKSNDELRYGDSIVLLAERIFGFLQASPMKN
EENQLLIRPIDASQGLRTSTVDLETFQVQTCHEYEAQDRLQEFLVKHGLHHPSDVARLDE
DQKAFLEEVQNLAEEEIKGNEERQLFHLGRPIRYGDPFQLLHVKTRLFVTLENHSIKVSL
STKFPSSSRSSFAFHLTEGQKGSQFIFDTPARLELGVSQEGVVRPGDAVVLESIAYEGKR
LSALKRQGENVWSIHASDDDPCELTIQVQAQAKPALSGSSLKYNSLSQATASAKKELEAS
LHVVEERRQGIAREMALLDMRLTDVNKGFDQMVLQMMLHFQELHQALEARENQLLSEARK
RIMEKVTYLKERREELSKANDEADNGIQFASKVLAMDNDVEMLQMQPHVMRRLSSVKGAV
HTSSLPTENLTFRYTYNERLIDSIGEHGEIFIGSAHEERAVPSSKRAARPSSAHAAARSS
EAEPPRPSSAIHDGGTKSTSKQKEKIGKQLQFWHGSDHPALGEWLSDLRQSGDSIRKSKS
ANDSYNKKTRISASFSGKTRGSKSTDRRETSMDGRRRAVDSSAAFDASMADLSLDSKSHR
QSSDIKRMHERMTLASMSKITPKRTSAPLRDYYEG

BLAST