GenomeNet

>tr:L1IS85_GUITH [L1IS85] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EKX39131.1, ECO:0000313|EnsemblProtists:EKX39131};
MATRGGSKKSEEASSISPRTKFTSIMLEAIRRARLAVLRHFHARESEYAVVFTSGCTQAI
KIVAENFRWAAGRSVFAYTVNNHNSVLGARQYAKSAGCAYHPIPHAQAAEVLESAAKDAD
EGSKEQTTFSLFAFPAECNFSGQKLDLSWTERVQAGALNQLLGCGGDTRWKVLLDAAKHA
STSPLRLDGEHKPDFITLSFYKMFGYPTGLGALLIRRESAACLEKKTFAGGTVLAARADD
DMFVLRESLHERLEDGTIPFLSIMAAELGLRHLEEIGMEGIEQHTWSLRDFFASELGKMR
HANGRKAAMVYGPPPSSPSSAVGSICCFNMLQPAGGLLDYSHVEELACLVGINLRTGSFC
NPGANKEMLGHTSEDVELFLREGKVCGDRRCVIGGKATGAVRVSFGYMSTFDDARRVLRF
LETNFVDKGEEEEQAGGAGAQDERIATVQELILFPIKSCAPQIVSSSSGWLLTSSGLFLD
RKAEPNMAHVQPSIVMEERAMMVRCLSKPELGTLRISLEEEDVDRMAGEGGGGGGGGGGG
GGGSLSSLGGMLFKGEIWGGRSTTRSFRVCGRKEVGLCYDKSVNEWFSKPPQPDRRSGSA
AILEEEKQAKTFHSHGGQLLMVSEESMYGLWQRLRAKHPSSSSSSSSRPRTPGGLGKLQG
QI

BLAST