GenomeNet

>tr:L8FS22_PSED2 [L8FS22] SubName: Full=Thymidylate kinase {ECO:0000313|EMBL:ELR02511.1};
MEAIDAKGRGPFIVVEGLDRSGKTTQTKRIEAALVGEGYKVKLRRFPDRTTVIGEMINNY
LQSKSDLEDHVIHLLFSANRWELAKQIEKDIADGYTVICDRYYYSGVVYSAAKSNPQLSL
PWAREPEVGLPRPDLVIFLDLEPEVAEERGGYGDEKYEKREMQEKVRKLFHALNDSEEEE
ASDMVIYDAGKSLEEVTKDVLQSVSSVSLAVKQGLHPELRKVGKWKREH

BLAST