GenomeNet

>tr:L8GDP7_PSED2 [L8GDP7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ELR10241.1};
MMMALISRRMGPLQLQNQERLFIWSREMHYWRAPVPEMWIDILQKVKAAGIPQCKGRNFE
RLFEIAKEVGLYVLFRPGPYVNAKATASRFPGWVTTGAYGRLRNNDTRHTDAWTPYMNRM
SQIIAKHQVTNGGNVFIYQIKNEFGNQWLDRSCDLSECTGTNGNVPDFTTFEYYTSFQDV
ALTQPSFLAEFQGGSYLPRGGPKGGCVNNTGPDWVNVFYRHNVAQNIAAANVYMAFGGTT
GIPFPGVGTSYDYSAPISETRFVSDKYSETKLFAQFLRVARDLTKVDRVNNGTTYASNLA
IMTTELRNSDTNAAFYTAHALSLSTDRSPFKLDVSTSAGRLNIPQNGGDIAVNRRLLSLI
FSVGREKLTYSTAEVLTASITASQSFSSGCRLAKVESSSWTV

BLAST