GenomeNet

>tr:L8WCQ8_THACA [L8WCQ8] SubName: Full=Beta-galactosidase domain-containing protein {ECO:0000313|EMBL:ELU35961.1};
MVSHFQIGKDLDSMRVPTWLTNSSGSLRMCFTKTIMPLERTSSRTNWGNLAYPGIYTSYD
YAASISEDRTLRPKFSEIKLQGLFLHATPHYHLAGRISTGTSLSSSQQIFTTHLATPQGQ
NLYIVRQTTNNSTARVEFDLKVNTTGGQVILPGLALNGRESKIIVSEYPFGKSLLRYSTG
EVRDLM

BLAST