GenomeNet

>tr:M0B4Z9_NATA1 [M0B4Z9] SubName: Full=Glycoside hydrolase family protein {ECO:0000313|EMBL:ELZ05976.1};
MTTPEHPTIDGPNFEYTFDASRGTLRSLERGGQEFIEQGPRLNVWRTPISNEEVDWGAAE
AEEWYELGLDRLEHEVESIEVTEVDDGVTRVRIEALLFAPDTDARFETTYLYHVFGTGDV
LLGVRAVPNAAIREGITNWLPRVGVQLELPEAFDELSWHGNGPVETYPDRNDGTKIDTYA
GSVAEQYVPYVSPQEYGNKTNVRWATLATGRGVGLDAFGYPQVNVSAHDVANLDRARFEY
QLESRDGVVCNVDHAVTGVGGTPVQARSEHRVVPDGPFEFVVGFRPRVGEDPSPMELSRR
RLPYAFASTNAIGEFEADYIPETGTITASAVVRNAGGDAAEIDAPLTIDGEVVSSRTVEL
QPGAKTDVAFEYDAPETGVFEVAIGDASPVLFTAPRLSLAGTWRFRAGDDPAWATPGYDD
GDWESVELPATWEEHSDYTENDAFGWYRRSFDVPETWAGYALSVPVGRVDDVDETFLNGD
RIGQTGSFPADEGGDGYESAWERSRRYTVPPSAIEFGGENVVAVRVYDGGGDGGLYDGPL
GPITAVSVDD

BLAST