GenomeNet

>sp:M1AZJ6_SOLTU [M1AZJ6] RecName: Full=Protein kinase domain-containing protein {ECO:0000259|PROSITE:PS50011};
MTLSQSLSLLLLVLVFRLNGSSAAEDEVRSLLEFKKGIKNDPLSKIFSSWSQTGLSNLSA
CPKSFHGVVCDENSDYVFSISLDGLGLVGDLKFSTLSGLKQLKILSLSGNSFTGRVVPAL
GSMLTLQHLDLSGNQFYGPIPARINELWGLNYLNLSNNNFTFGYPSGISNLQQLRVLDLH
NNGLWGDIGELFLELKRIEHLDLSNNSFFGSLPTSPENVSLSSTIQVMNLSHNKLGGGFF
PGKLLEAFENLMVLDLGNNAIMGQLPSTGFMHNLRVLRLGNNQLYGLIPDELLQGTGPLE
ELDLSGNGFSGSIPIVNSTKLRVLNISSNHLLGSLPSSIGNCAVVDLSRNMLVNGISAIE
SWEANLEIIDLSSNRLTGNIPTITSQFQLLTSLNFGNNSLEGTLPSALDTLPRLVKLDLS
TNKLGGPIPSTFFTSTTLMNLNISGNQLSGSIPLEGSHASELLVQSPYPALESLDLSENT
LTGNLSSAIGNLRRLQVLNLAKNQLSGMLPTELGDLRSLEFLDISNNNFSGMIPENLSSN
LRVFNVSNNELSGAIPDNLRNFNESSFRPGNSNLAIPSNWLHDNHGDPDQNSQHHHNSKS
SIRVAIILASVGAALMIGVVLLAYHRQRFQDFHLPSGFNSQSAGRDVKLGRFSRPGIFKF
HGSSEPPPTSLSFSNDHLLTANSRSLSGQIESGTEIVEHVFPEGVTAVSASTHLGTVGNN
PATSGQRSSPGSPIASSPRFVDTVEQPVTLDVNSPDRLAGELFFLDGSLSFTAEELSRAP
AEVLGRSSHGTLYKATLNSGHVLTVKWLRVGLVKNKKEFAKEVKKIRYIRHPNAVPLRAF
YWGPREQERLILADYIPGDSLALHLYETTPRRYSPLSFNQRLKVAIEVARGLAYLHERGL
PHGDLKPTNIILVGADYSVRLTDYGLHRLMTPAGIAEQILNLGALGYRAPELATATKPIP
SFKADVYALGVILMELLTRRSAGDLISAHSAAVDLTDWVRLCDQEGRGMDCIDRDIAGGE
EHCKAMDDLLAVSLRCILSINERPNIRQVVENLGSISV

BLAST