GenomeNet

>tr:M2Q232_9FIRM [M2Q232] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MSIAKLELLEIEFPVESADTILSKLIKSEIFHPEPASKFSDSVKDVKVLSTSNPYHELIV
KLEDAAKKYHISFNKDAIADKDMDVSSAADFYEQFSTRIETINDTREKLSEMIEENKETI
KNISYMKGSDINFDQLFTTKYLQVRFGRLPQANLSKLEYYKSQEFLYRVFSEGSEDAYIL
YVTSRIKAPEIDNIFSSLFFERIRVPEFVHGTVEDAIEELNKENRTGIDYIGVLNQRSRD
HINQNIAELSIIYNTCQILDDITEAKKYVVVFGKSAAVYGFAEVADATKIKNEFEQMNMV
HVDLTPPQGDYRLKPPSQLKNNWFSKPFGMFVEMYGVPAYTDMDPTNFVAITYCLLFGIM
FGDAGQGLVLIIVGFLASHFKQMKLGEIGMRIGIFSIIFGIFFGSVFGSEKILVPFFTPM
DAKNTMTLLGTAIGIGAVLIIVSIIFNTYTNIKKKNIGEYAFSQNGLSGLVFYVCILLFV
MNALLGLKLHLGVLFVLIGLLLPVVLMFLKEPLTRKIKGYPMFPEGFGSFFTEGFFELFD
VLLTFITNTMSFLRVGGFVLSHAGMMLVVYTLAEMVIKPLGLPGYFIILMIGNIFVMVLE
GLIVGIQVLRLEFYEMFSRYYEGNGRPFVSMKKRLER

BLAST