GenomeNet

>tr:M2SNR8_COCSN [M2SNR8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EMD58417.1};
MRFQLSDKETSRWLNIDIRPLPPSRRQWTAWTYSAFWLAWHVSLTNFTMGSSLVALGLSV
WQVMLAIVIGRAIIAAIAVAVGTIGADWGIGFPVYSRALWGMRGSYVPMFQRIVCGIVGI
ALQSYLGGICITAMLSAMFPSFHRMRNTLPAGANVQTQQLIGWVLFNLITVPFLCGKLEK
KRIVRVFVALNAYSFCVLFGIMIWAVVRAKGAGQLLTEGSLPDSDIGWGICKAVTTVVGS
IAVGLMSQPDYTRFARTPGAQVTGQWTSIMVFGTLMPLFGCITASATQSIYGKAIWNPTE
IALLWLQRDYSAKTRAASFFVSLGLMLCQLVVNTFENGFSTGMDLAALAPKYINIRRGAL
LALTIACGTCPWQLLTNAAVFLNVVASYTIIIGPILGIQIIDYFVLRSRRIQLSALYEIN
PDSAYYYTYGFNPRTILAWIVAWIPQLPGFINAVNPNIHVPFGAAKLYDLSFLFGGTVGA
LIYLGINLVFPPSNLGHVDEADVFKVSSEEEAGQRSIKAIVKREVNEVA

BLAST