GenomeNet

>tr:M2SPG9_COCH5 [M2SPG9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EMD87230.1};
MADIPKVGRSNHGGGRVPCEDDIKRPSLVKIGGVDNDVTHGRQEELGGWRGVLNFLEKRG
DVEVRGCTPVGYEDRNETAYSKIFTLWFCMSCNPLPVTFGMVGTMSFGLSLRDAALVILF
FTLVSTVPVAYMCTWGPVTGMRQLVQARFSFGKYFVSLLILLNLATLTGFCVVDSVIGGM
ALSAVQDGTTINATVGIVVIALLSLVISFCGFGVLHHYERWAWIPALLALIIAAGCGGQK
LGHQVAAPAATASQVLSFGGLVASFMLPWAALASDFSTYMHPKAPRSRIALYTYIGLALP
TVLLMTLGAAMGGATPNVPSWQAGYEANAASGVLAAMLHPAGGFGRFVTVVLAFSMLGNL
SATMYSVTLNLQMLVPWLFRVPRIVFSIVITGIVIGVAVEASKSFFLNLENFIGVIGYWS
AAFIGIVLVEHVLFRGGSFAAYTEDADAWDDGQKLPAGYAALGAFLLSFGLIVPCMGQIW
WTGPIAETTGDIGLEVAVVLSALLYVPLRTWEKRVCRR

BLAST