GenomeNet

>sp:M3ZTE9_XIPMA [M3ZTE9] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000005492};
MVLFLSCDLVSPCAVTNYNNVLEAGSDSDDEDKLHIVEEEGSLADGADCDSTLPDEEHPS
VPSWDPVKEDCASDGEDDVSTDALVEEMLQQGDTAIIYPEAPDDDLQRQGTPDASVHDEN
GTPDSFSQLLTCPYCARGYKRYSSLKEHIKYRHEKTEESFSCPECSYSFAYRAQLERHMS
VHKGGRDQRHITQSGGNRKFKCPECGKAFKYKHHLKEHLRIHSGEKPYECSHCKKRFSHS
GSYSSHISSKKCISVISVNSRQRLGGSRNQAQGSPPGLPTSPSVHCGQIREKLEHSKPLQ
EQLPLNQIKTEPMDYEYKPAVITPPAMAAMNGGVFSGGAAAPLQGTVQAVVLPTVGLVSP
ISINLADLQNALKVAVDGNVIRQVLENNAKGQVNSGLTTQTLHPPQQQLISAISLPIVGQ
DGNAKLIINYSLDPNQGQLTPHNLKKEPVSPAQSAVDSIKSQKLPEDLSVRGNRDQAQQK
EEKTTTTCLLCENCPGGLEALHALKHCKKEDLRLNGAGLDKSEAVAALLSDGGLCNHPKN
LLSLLKAYFALNAEPSKDELVKISDSVSLPIHVVKKWFSKMQEGQISLGAPTPPSEEEDS
YESHSVVSLVPGKDTATISRSVSQESPTEATPAEVNGTHSSPASPSPLNLTAGGPTQADT
PESTEGPLDLSLPKPAREEAESMVPAARVYPSASSRQTTEEEPLNLTCTKKDTSPLSAMG
GSPLALYANQPSAKPLDIVTTMQCLRALTNNSNKQTILIPQLAYTYTTTANSPAGTETHE
TIHLNGIKEERLDLGSEGFSVVDELNDSDSGPARKKMKKTDSGMYACDLCDKIFQKSSSL
LRHKYEHTGKRPHECSICSKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHM
NHRYSYCKKETQSQAGGRESPAEEDGEVPTERQRQDTAPSLLDSDERGSSTREDEESEEE
EEGVVDMNDIQVVQIEDEEEEDKEERKEEQMETEREDGTLEMEEKEEVDVRQEEMRRSVQ
EEEEESDAGKDEVTDKEGGAAEEEDGEDGEVQEESRGETNQSGVSQDEEETPEEKADTD

BLAST