GenomeNet

>tr:M4EZH6_BRARP [M4EZH6] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra034219.1-P};
MEDPLIGRESRGGGGSTDRIVRRSEAITHGTTFQKAAALVDLAEDGIGLPEQILDQSSFG
ESAKYYFIYTRLDLIWSLNYFALILINFFEQPLWCENKPTPSCKDRDYYYLGELPYLTDA
ESIIFEARSRIFWTSRLNLVKVACVVVLIVDVLVDILYLSPVAFDFLPFRIAPYVRVIIF
ILSIRELRDSLILLSGMLGTYLNILALWMLFLLFASWIAFVMFEDTQQGLTVFTSYGATL
YQMFILFTTSNNPDVWIRAYKSSRWSSLFFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQ
VSGMDQMKRRMLEKAFGLIDKDKTGQIDKEQCIKLFEQLTNYRTLPKISKEEFGLIFDEL
DDTRDFKINKDEFADLCQAIALRFQKEEVPSLFENFPQVYHSALSQQLRAFVRSPRFGYA
ISFILVLNFIAVVVETTLDIEESSAQKPWQVAEFVFGWIYVLEMALKIYSYGFENYWRDG
QNRFDFIVTWVIVIGETATFITPDENTFFSNGEWIRYLLLARMLRLIRLLMHVQRYRAFI
ATFITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKQLFKTEMAEDDYLLFNFND
YPNGMVTLFNLLVMGNWQVWMESYKDLTGTWWSIAYFVSFYIITVLLLLNLIVAFVLEAF
FTELDLEEEEKCQGEDSQERRNRRRSAGSKSRSQRVDTLLHHMLGDELSKPECSTTTATD
T

BLAST