GenomeNet

>tr:M7UR28_BOTF1 [M7UR28] SubName: Full=Putative choline dehydrogenase protein {ECO:0000313|EMBL:EMR89428.1};
MMFPKRSLGLVALFSLTASAFKSQHSHQHLHQRAANASSSSANITLDPYEYVVVGSGPGG
APLAARLALAGHSVLLIDAGEDHGDDIEMQVPALHVLASEYDPIRWDFFVHHYANETRQA
RDSKMTYQTTDGDFYVGLDPPEGATPLGILYPRTGTLGGCAEHNALITILPQETDWQYIQ
NITGDDSWAPAKMRDYYKKLESCHYLSTDVTGHGFDGWLQTEVTNPELIVQDQKVLSLVI
AAATTMGKGLLGRLITTVTGLAEVLALDINNDSPNRDQVDALYQVPLAMKFPEYSRSSPR
DFVWSVANATNSDGSKKYKLDVQLNTLVTKVQFNTTAATPRATGVEFIVGKSLYRADPRS
KNVGDSDGTYGSVAATKEVIVSGGTFNTPQILKLSGVGPKAELEKFGIPVIVDLPGVGTN
MQDRYEVGIVGNSTSDFSLLKECTFLNGTDPCLEQWETLPLLKGGYSTNGIALAYPKHSS
VADGVQDLYLGGVPAYFNGYFPGYSIHALAKRNIWTWLTLKAHSRNNAGTVNLRSADPRD
TPEIVFNYFDTGVGGDEDLQAVYEGMKFGIEAFENLIPLDGSFTRIWPDASITSEEDLKQ
FALDEAWGHHASCSCPIGADDDEMAVLDTNFKVRGVDGLRVVDASVFPKIPGMYIALSIY
MISEKAAEVIIAEASS

BLAST