GenomeNet

>tr:N6X718_9ALTE [N6X718] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MNKYTEAVSQLTGTQSQEQQTPAPENKYSKAVSSLAEQRRSVLARSVNQAVTEQPDDLAY
IRRLSEDTGLSPYIVRENRDDIERRVKQREMGAQIEGFSQPGKEWLSRPDNLGVAQDDLP
ALRALDDAIANRDWYAQDSVDKLIGSVKTGAINVRQAGSSVAATPALNRIAEFDRLDSLL
NEGGREQALGYIRENDRALAGTALKADMLRYIGADDVERADLRAMAQEQISAAGTEIAVQ
ETQRQDIPQDPLQMQAARDGTVGGVLSAIAKDPGMIARLTTESIVTSLPTLAAGALTGPL
GAAGASFSTERGLGLVSALRESGIDTTNPDAIIQALTDPAFLEDAQRRSEMKALGVSMLD
LVGAGIASRSLSPSSVAGRTLSARQRELINIFAQMPVQGVQEAAGEATGQFLADGEVNQA
EVALEAIGGFFGATADVVAFSGGRVFDGIVNNANNYRRAKRDREYLTAVKDAANQSKLRQ
RDPKAMKELLDRLSESGPVNEMYISGKDFQELFQSNNMDPAEYAQKMESVGEQYYESLVT
GGDIAVSVSDFASVIAPTEVADAFIQRSRTKTDGMSPAEADQWIQEQARPALDAIINYDG
DQAGAGAQRVYDNVTEQLMATGMDRGAAERHASLYRAFFGVMGEVEGVDPFDLYQQYSLS
ITRERPGVLQSDDLAALDPLLNRIREGDIPGPDTEDANLRQTAADIASLQAELDRLGIDL
QSTDNATARAELGRVVYGTGETNADTVLSQDEMQVDEVTDSEEIRRILDQYQRRQSPEQQ
VTFRTVGGREVDQSWREATSFRGNDGQPAPLYRGSSRQLTGSDFQPESLGFATQNPSAAL
GVWFTSDRSDAGRYGNVSEYYADIRNPRVYSSDSIPEFNSAEDAAALREQLKSEGYDGIV
FDYTDVDGPIHAIAFEPDQVITGATESFNQDVGGKRGVIRIDRANRNFNIELLANADLST
FLHESGHFFLEVLGDLAQAEGASQRVQGQYQALLDWFGVESREQIGTEQHEQFARGFEAY
LMEGKAPTPELQSVFARFRAWLLAIYKRLRALDVDLTDEVRNVMDRILATDEDIERAREG
ASMTDTLGDIAAMEWTEQERAQYRDVVADAKEAATAELTTRQMKDLRKTNEKWYKDELER
VRDEVRQSLNNDPTYQVLAHLQHGKQPDGTSLPDSLNAVKLSRGILVAQYGEAFLKQLPG
PGNKQHSGPYLYSREGGIDPQVMADIYGFSSGDELVQTLVASRPMREVVEERATQIMRER
YPDINLTGEAAEAAIAAVHNDKAAERMLLELKKLHGKSRFSRNPMTPARVMREAAVRLVN
GQRVNDIRPDLYRRAESRAAREAFEAATNSDFDVAFDAKQRQLLNHYLYREAVKARDESE
SILEYVRRFDKKATRQRIGKAGGEYLEQIDALIDQYEFRRVSLRQIQRRRSLEAWAQEQS
ENGLDPAIPESVMRQAERVNYKEVPFEELVGIRDAIQSIEHLARTKNKLLSSQYKREFAE
TVDDIVSSIEASHEIKREPPQFVRGKLSQLKDWGDQYVAAHAKPEFIFEYLDGNKSMGPV
WQALFKPMADAENAENRMTGETMEKLTEIMKPFKEEQRAHWFTQKQYLPEVGVSMTKSNM
IALALNWGNEGNREAVRRGYDWTDEQVMSVLNRLSQDEWQMVQSIWDLVDSFWPQIAQLQ
KDLVGVAPEKVESAPIQTRHGTFKGGYYPLKYDPRRSFLQFRRDEGVNTQDLFENNFLRP
ATKKGHTVERVGSAGQSVRLDMAVLGEHIYQVIHDLTHRKAIIDVDRLLGNVRVRHAIEG
SAGREAYRQLRPWLQAIANDTKLPTLPWERVISHMRAGGTIVNMGWKFTTAIVQPLGYLQ
SVDQIGAKYAWKGLRDFFGSPTKMKKQVDFVFERSEAMKNRQRTFDRDVRDYARKLEREG
KMDQVRQSFFWMTGMLDMSVSVPTWLGAYRKAMEGGVENIAKGDEAGAIDYADQAVRESQ
SSGAVKDLARIQRGNEAFRAFTMFYSYFSALFNLLRRRRQDLSLGNINVPQFAASMALLW
LAPAILGELVAGRGPNDDEEWAQWAARQGMLYPLSTMIGLRDVANAVLTPYGFNASPAYD
GLDQTARALQIPYKAMTGEELKRTDVKSAVLATSYWGHLPGRQAWITGEYLFDLMEGNER
PENPAEFAKGIMFSRPADER

BLAST