GenomeNet

>tr:N6Z028_9RHOO [N6Z028] RecName: Full=Flagellar brake protein YcgR {ECO:0000256|HAMAP-Rule:MF_01457}; AltName: Full=Cyclic di-GMP binding protein YcgR {ECO:0000256|HAMAP-Rule:MF_01457};
MTIEHELTRVELLQADDASKYLLKDDREILFIMRRLVDARSLLSARGEPGYDSFLTALLQ
ISSDGSTLILDGSPDAALNARLEQAERLDCVTQLDKVRIQFMLDRPVFQTWREGPAFSAA
LPGELLRLQRREFYRLQAPVTHSLTCTVPLPHAGELALRIIDISGGGIAIAVPPADAPFA
PGDEFAGCRITLPDSPPISARLIVRNLFRLTTRNGVEMLRAGCEFSDMPRGADEAIQRYI
LRIERERNARQHTLG

BLAST