GenomeNet

>sp:RBS_CYAM1 [O22024] RecName: Full=Ribulose bisphosphate carboxylase small chain; Short=RuBisCO small subunit; EC=4.1.1.39;
MRVTQGTFCYLPDLTDEQIRKQIQYAINQGWAVSVEYTDDPHPRNSYWEMWGLPLFDVKD
PATIMFEVQECRKQFPNHYIKVLAFNSTKGIESTALSFIVNRPANEPGFVLRRIESNDRV
QRYQIHSYATEKPEGSRY

BLAST