GenomeNet

>sp:Y1421_AQUAE [O67415] RecName: Full=Putative sulfur carrier protein aq_1421;
MENVKEDRTLDLSGLSCPLPVVMTSETMRKMEEGQVLKVISTDPGFERDIWSWAKQSGNI
LLKVEKEDGKTIAYIKKASEAHEPSLWYWIKFHSLGVKLHIRQFCIQINPFVKKPTHFIT
FSAISEGTRAEKELKKLGEKDAVLIPIPDEIDPRCGVVLAVHGEKKAREIYEKLKDMDIA
VEAIYEKKGKEYERVYP

BLAST