GenomeNet

>sp:PYR1_MESAU [P08955] RecName: Full=CAD protein; Includes: RecName: Full=Glutamine-dependent carbamoyl-phosphate synthase; EC=6.3.5.5 {ECO:0000269|PubMed:9218000}; Includes: RecName: Full=Aspartate carbamoyltransferase; EC=2.1.3.2 {ECO:0000269|PubMed:9218000}; Includes: RecName: Full=Dihydroorotase; EC=3.5.2.3 {ECO:0000269|PubMed:9218000};
MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPSDEEDEFGLSKWFESSENHVAGLVVGECCPTPSHWSATCTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQSGTEPSTLPFVDPNARPLAPEVSIKTPRVFNAGGAPRICA
LDCGLKYNQIRCLCQLGAEVTVVPWNHELDSQKYDGLFLSNGPGDPASYPGVVATLNRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVD
ADSLPAGWTPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREA
VAGNPGGQTVKERLVQRLCPPGLLIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDVELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRM
KRIVTHAQLLEQHRGQPLSQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPDGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ACDGVVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPIGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGAVAGSAAGLKLYLN
ETFSELRLDSVAQWMEHFETWPSHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEE
ILLIKTAKAQGLPVTCEVAPHHLFLNREDLERLGPGRGEVRPELGSREDMEALWENMAVI
DCFASDHAPHTLEEKCGPKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPLQEDTYVEVDLEHEWTIPSHMPFSKARWTPFEGQKVKGTIRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQPPPSAPATTEITTTPERPRRVIPGLPDGRFHLPPRIHRASD
PGLPAEEPKEKPSRKVVEPELMGTPDGPCYPAPPVPRQASPQNLGSSGLLHPQTSPLLHS
LVGQHILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPSVWDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF

BLAST