GenomeNet

>sp:Y2355_CORGL [P0C1E8] RecName: Full=Uncharacterized protein Cgl2355/cg2587; EC=1.-.-.-;
MKFVMYPHLWESTTAVIEGGGHERVEDIKDADFIFFNGSAPEFPDLPENIKFVQASMAGI
DALVKRGVVNEKARWANAAGLYADTVAESTIGLILAQMHMHATTRLAKSWSVRPEVENNK
SWLHDNKTVAILGAGGIGVRLLEMLKPFNVKTIAVNNSGRPVEGADETFAMDKAEHVWAE
ADVFVLILPLTDATYQIVNAETLGKMKPSAVVVNVGRGPLINTDDLVDALNNGTIAGAAL
DVTDPEPLPDSHPLWEMDNVVITPHTANTNERIRALTGELTLRNIELFEAGEQMATEVDV
VAGY

BLAST