GenomeNet

>sp:YO10_ADEG1 [P20747] RecName: Full=Putative Ig-like domain-containing protein ORF10; Flags: Precursor;
MIDKRNKKAVTHISTCLCHSSIPIYGDSPFLNTHRAAMDPRPLVLLLLLASHISTFRQMY
FEGETIHFPMGIYGNETTLYMNDIILEGTRANTTTRTISLTTTKKNAGTNLYTVISETGH
NATYLITVQPLGQSIHHAYTWAGNTFTLQGQVFEHGNYTRWVRLENAEPKLIISWALSNR
TINKGPAYTANMDFDPGNNTLTLHPVLITDAGIFQCVIDQQTNLTLTINFTVSENPPIVA
HLDIHKTISRTIAICSCLLIAVIAVLCCLRQLNVNGRGNSEMI

BLAST