GenomeNet

>sp:SDHB_HUMAN [P21912] RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; EC=1.3.5.1; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor;
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

BLAST