GenomeNet

>sp:PROC_MOUSE [P33587] RecName: Full=Vitamin K-dependent protein C; EC=3.4.21.69; AltName: Full=Anticoagulant protein C; AltName: Full=Autoprothrombin IIA; AltName: Full=Blood coagulation factor XIV; Contains: RecName: Full=Vitamin K-dependent protein C light chain; Contains: RecName: Full=Vitamin K-dependent protein C heavy chain; Contains: RecName: Full=Activation peptide; Flags: Precursor;
MWQFRVFLLLMSTWGISSIPAHPDPVFSSSEHAHQVLRVRRANSFLEEMRPGSLERECME
EICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPPLDHQCDSPCCGHGTCIDGIGSFSCS
CDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRCACAPGYELADDHMRCKSTVNF
PCGKLGRWIEKKRKILKRDTDLEDELEPDPRIVNGTLTKQGDSPWQAILLDSKKKLACGG
VLIHTSWVLTAAHCVEGTKKLTVRLGEYDLRRRDHWELDLDIKEILVHPNYTRSSSDNDI
ALLRLAQPATLSKTIVPICLPNNGLAQELTQAGQETVVTGWGYQSDRIKDGRRNRTFILT
FIRIPLVARNECVEVMKNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVS
WGEGCGHTNNYGIYTKVGSYLKWIHSYIGEKGVSLKSQKL

BLAST