GenomeNet

>sp:YLH6_CAEEL [P34360] RecName: Full=Uncharacterized protein C48B4.6;
MSKTAALTDIEKSKATISFWKFIAMFIQALFLIGLVEDLCYYHMFYSRQYFFLEILVTIH
TGFSFIVFLIEHKPLIMLHVGYMTLLTIIPIAYMVMQGVEFGILIFDDYHILVFRDFHKF
GCSIMFSLYYIGYIVVCFLFIEALEKKPVLPQVYSIKPKLVAAVNPSNNCNVYPML

BLAST