GenomeNet

>sp:ERCC3_MOUSE [P49135] RecName: Full=General transcription and DNA repair factor IIH helicase subunit XPB; Short=TFIIH subunit XPB; EC=3.6.4.12; AltName: Full=Basic transcription factor 2 89 kDa subunit; Short=BTF2 p89; AltName: Full=DNA excision repair protein ERCC-3; AltName: Full=DNA repair protein complementing XP-B cells; AltName: Full=TFIIH 89 kDa subunit; AltName: Full=Xeroderma pigmentosum group B-complementing protein;
MGKRDRVDRDKKKSKKRQYEEEEEDEDDIPGNESQEAVPSAAGKQVDESSTKVDEYGAKD
YRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESS
HPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISKTAAEGSGGPSTSQGVDAQ
ATSDIPKDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCICLEYPLLAEYDFRN
DTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRK
RCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKR
SWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVD
LNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPN
KFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHN
PKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFF
YSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAA
TDLDAEEEVVAGEFGSRSGQASRRCGTMSSLSGADDTVYMEYHSSRSKASSKHVHPLFKR
FRK

BLAST