GenomeNet

>sp:AAKG1_RAT [P80385] RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg;
MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP

BLAST