GenomeNet

>sp:PFKA1_KLULA [Q03215] RecName: Full=ATP-dependent 6-phosphofructokinase subunit alpha {ECO:0000255|HAMAP-Rule:MF_03184}; Short=ATP-PFK 1 {ECO:0000255|HAMAP-Rule:MF_03184}; Short=Phosphofructokinase 1 {ECO:0000255|HAMAP-Rule:MF_03184}; EC=2.7.1.11 {ECO:0000255|HAMAP-Rule:MF_03184}; AltName: Full=Phosphohexokinase 1 {ECO:0000255|HAMAP-Rule:MF_03184};
MNNSVYGVAFRSLSTGDEKLYKEATRFYHSLGFQTVKLYDNFKNHDDSNLIVGTSKNSVK
ECWLESFKLSELDSQGFRVPQQEASNQLQTDGVMIKLRLVDTEPLNQTADTVVYYTVSLD
EVSKIGERVDDHNVKLVDPLGNVVLVTDSHDGKELNASEFIAPKDSSVEQKITVELVDKD
SKKKKIAVMTSGGDSQGMNAAVRAVVRSSIYYGCDVYAVYEGYEGLVKGGDYLRKMEWKD
VRGWLSEGGTLIGTARSKEFRERWGRKQACSNLIDQGIDALVVIGGDGSLTGADLFRSEW
PSLVEELVKDGKFTEDEVALYQNLTIVGMVGSIDNDMSGTDSTIGAYSALERICEMVDYI
DATAKSHSRAFVVEVMGRHCGWLGLMSGIATAADYIFIPERAAPHGKWQDELKRVCQRHR
EKGRRNNTVIVAEGALDDQLNPITAEQVKDVLVELGLDTKITTLGHVQRGGTAVAHDRWL
ATLQGVDAVKAILNMTPETPSPLIGILENKVIRMPLVESVKLTKQVAAAIEAKDFDKAIS
LRDTEFIELYSNFMSTTVNDDGSQLLPEADRLNIAIVHVGAPSAALNAATRAATLYCLAH
GHRPYAITNGFSGLIQTGQVKELSWIDVEDWHNLGGSEIGTNRSVAAEDMGTIAYHFQKN
KFDGVIILGGFEGFKSLKQLRDGRDQYPIFNIPMCLIPATVSNNVPGTEYSLGSDTCLNA
LVKYTDAIKQSASSTRRRVFVVEVQGGHSGYVASFTGLVTGAVSVYTPENAINLKTIQED
LALLKESFKHEQGETRNGKLVIRNEMASDVYTTELLADIITEQSNDRFGVRTAIPGHVQQ
GGVPSSKDRVIASRFAVKCVKFIEQWNKKNTAADNEDFKILRFNYVNGVKQYTVLDEDLS
AAVICVNGSKISFKPIAHIWENETNIELRKGQEIHWEEYNEIGDILSGRSMLRRKIQKEQ
QEESSLPSVADTPLSSVTVSTSAAKEDSALYV

BLAST