GenomeNet

>tr:Q0AR87_MARMM [Q0AR87] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABI65200.1};
MSVLKTKFWVDALIRRAELGLASVYVIRRGDEDAGSVLVKVVVDRSLAQLYVPARDDQGE
RVWSRRAETDEASLDAWCHKRADQDPDLWVIEIEDRHGRHFLTEPVELPGPG

BLAST