GenomeNet

>tr:Q0CFT8_ASPTN [Q0CFT8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EAU31708.1};
MAGFYFFWSYHSASEGEFDFTTGAHNLQRLFDYAKQAGLYVIARAGPYCNAETSAGGFAL
WAANGQMGRERTSDAAYHARWQAWIAAVGEIIAANQITHGGPVILNQHENELQETVYAAD
DTRVQYMEQIAAAFDAAGIVVPSSHNEKGMRAVSWSTDYHDVGGAVNVYGLDSYPGGLSC
TNRDAGFRLVRTYYQWFQNYSFTQPEYLPEFEGGWFQPWGGAVYDTCAAELSPEFADVYY
KNNIGSRVTLQNLYMVFGGTNWGHSAAPVVYTSYDYGAPLRETREVRDKLKQTKLLGLFT
RVSGDLLKTYMEGNGTGYTSDAAVFTWALRNPDTHAGFYVVAHESSPSRAVTDFALNVNT
SAGAMTIPDIQLDGRQSKIVVTDYSAGRASLLYSSAEVLTYTTLDTDVLVFYLNVGQTGT
FAFKHAPRGLRFQVYGESKLRAANTTHGTQYSYVQAEGVTAVKFSNGVVVYLLDKASAWN
FFAPPLTSTPEVAPDQHIFVLGPYLVRGASIKGTTVEITGDNANTTSLEVYAGDDKVTKV
KWNGKPVKTKRTAYGSLIGTAPGAEDVKITLPSLGPWKAQDTLPEIDPAYDDSRWTVCNK
TTSVNAQKPLSLPVLYSGDYGYHTGTKIYRGRFDGQNATAANVTVQNGVAAGWAAWLNGA
YVGGAVGSPSQVTTSAVLTFNQSTLRARDNVLTVVTDYTGHDQNSQGPLGTQNPRGILGA
TLAGGATFTSWRIQGNAGGERNIDAVRGPMNEGGLYGERMGWHLPGYEAAAAAAASSPLD
GVSGAEGRFYTTRFRLDLPADMDVPIGLQLGAPAGTAAVVQVFMNGYQFGHYLPHIGPQT
LFPFPPGVINNRGENTLAISLWALTDAGARLDRVELKTYGQYRSGFDFNRDWSYLQPRWT
DRAEYA

BLAST