GenomeNet

>sp:RS21_STRPC [Q1JMH3] RecName: Full=30S ribosomal protein S21 {ECO:0000255|HAMAP-Rule:MF_00358};
MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAARKRKKF

BLAST