GenomeNet

>tr:Q2GX66_CHAGB [Q2GX66] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EAQ86185.1};
MHPFRLPVPELWEDILQKIKASGMRMVSIYTHWGFHAPTPDSVDFSTGPRNITRFLEMAK
DNGLYVTVRPGPHINGELNGGGMALWATTDEYGALRLNGTAYTEAWTPYQDGISQLTRPY
QLTEDGTVLMYQIENEYAKQWRDEKARIPNLEAVSYMEKLEENARTNGIVVPLIHNVPNR
SGPSWSKDYDTVDAGGNVDIYGLDSYPQCWSCILDQCGPITPWAVSNYSDQFQYASPKQP
SLMPEFQGGATTPWDGPLGGCPERTGVGFVNFYYRDNIAQRVTMLTLYMIYGGTNWGWLA
APFLGSSYDYGAAISEDRSIGDKYYEIKNLGLFTRVADELAHTERVGTGLDYTNNTDLFT
TELRNPDTGAGFYVIRHADTASASEEWFVLKVNTSIGEFFVPKISSAVVLSGHEGKILVA
DFHFGDHTLYYSTAEILTYSIIDGRPVLVLWTPRGRSGEFYLKGAKEGTISSGPPVTIVA
IEHGIIIGYYDQKEVMTVLDFDNGVRVVLVDRKTAYEVWAPALTNDPKVPVDQTALVIGP
HLVRSALLTDNTTISLTGDTNRTTPLEVFTFSSMTRILWNGMDLPTTQTNHSTLRATIPA
PPSTDSFQPPQITSWKSHDALPERHPSYPDTGPAWSPLNTTTFPLSANPHGFHTGTLLWR
GHFTTTPNNTNTTTPTPIAIHLAIQGGAAHGWSAYLNGVYLGSWPGRKDTAVSNLTLAFP
EEVLVENMRENVVLVVSNGDVERCGKRVGLTVFREELWASQPSLN

BLAST