GenomeNet

>sp:PSBV2_SYNJB [Q2JIS7] RecName: Full=Cytochrome c-550-like protein; Flags: Precursor;
MPHLDQKLPMRWRIPSRLWAWVGILALLWLGLASPVAARIDPYVNQYLRVSGPVELPLDA
AGHTLTFTPEQLTDGKNRFQSACLNCHVGGATLPAPNISLSLKDLRGATPPRDTLQALME
YQRDPRSYDGSDSSYGCRPVPPSWMDDEAVNYPAPTAKRYGAGFQ

BLAST