GenomeNet

>tr:Q2NPZ4_SODGM [Q2NPZ4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:BAE75781.1};
MCLKAYNGHGKSFKLDTIDDTLTTEKLAPKKTLKGIAVFSSNDESVYDASMVKLSDDCDS
HDNK

BLAST