GenomeNet

>tr:Q2U0Y2_ASPOR [Q2U0Y2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:BAE64783.1};
MSPGLFVGRDAELRTIRKDLHPSSQGGQRKQQQQQRLAIGGIGGVGKTQIALTYAQTPHA
SYETVLWFNAATEISLKNSFATAAGLIFGSKVSQSLEGNEAVRRTREWLSDPENSKWLLI
FDNYDNPSDFKLDSYYPPAAHGAIIITTRQADQVTGRTALSERDNLLSVQLAERLAGLPL
ALATAGAYLRKSPFTFQRYLQEYENRWNIDPRRPVKLQEYQERTLYTTWEISYNRLMKDD
TEAAAMLRILAYFDNQSLWYELFRAGLKDGCPLYEVINNDISFNGAMTVLAEYSFLEFHP
GLKEWSMHKCVHDWVSASLRKAVGRQGYWYAFGCVSGSIEVSDEESLAYPLYSRYVPHAK
HLSQSRFLTSDIIEMITPERLRAVRGISSLLLYQTQYDSAVRLLKLFLQSQAAHDPDDDV
TLSIMNDLGYLYFAQKRYSEAKELLGTALTRKEKILEANDLSLVGTRINLGHVYTFQGDY
QAAKEMYLQALFGKDVAADGHILATLLLARVKSRLHSNSKHNDFACLYWRLEIAHNEKSL
IHSGLVTDLLDVSDNLCHLLGLTGKKNEAELMLKEVILIRETLQGPAHSSTLVSVSILGF
LYKDQGKFDDAEKLYERVFTEREKLYGPNHYSTIKVLQDLGHLHLKQNHFQDAEDSYTRA
LNGLKRTLGPHDERTIQVMLDLAFLYENHGKSVAAEQMYTQALTMREALLGSSDPLTLDI
AARLGQLYLTMRRLDDAENMLLRVLGYPSSPQAVGLEVIKRSDAALNLSSLYMLTKRLHD
AERLLLRMSTVIAQTPDPDNFWLRNGQLDKAEKEFITIREGCKEVWGSEHPLTAVVSESL
AKVYEQKQFQ

BLAST