GenomeNet

>sp:KITH_STAAB [Q2YUN4] RecName: Full=Thymidine kinase {ECO:0000255|HAMAP-Rule:MF_00124}; EC=2.7.1.21 {ECO:0000255|HAMAP-Rule:MF_00124};
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL

BLAST