GenomeNet

>sp:KITH_LACSS [Q38WJ3] RecName: Full=Thymidine kinase {ECO:0000255|HAMAP-Rule:MF_00124}; EC=2.7.1.21 {ECO:0000255|HAMAP-Rule:MF_00124};
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKSVIILTSGIDNRDGVGIVSSRIGLKREAT
PIFSDTNIYELVEATNPDAACVLIDESQFLERHHVIEAAKVVDDLNIPVMAFGLKNDFKN
ELFEGSKYLLLFANKIEEMKTICWFCRKKAIMNLRMNNGLPVYTGEQIQIGGNEAYYPVC
RKHYFNPPIQEEIEKEG

BLAST