GenomeNet

>tr:Q3SQU0_NITWN [Q3SQU0] SubName: Full=TrbL/VirB6 plasmid conjugal transfer protein {ECO:0000313|EMBL:ABA05351.1};
MNTGVIDRFLETFTRYIDSGFGLLGGEIGFLTSTLIVIDITLAGLFWAWGADEDVIARLI
KKTLYIGVFAFIIGNFNKLAGIVFQSFSGLGLKAGGSSLTAETLLQPGRVAQVGIDAGNP
ILKAAGDLMGYISFFENFVQIMVLMIAWAIVLIAFFILAVQIFVTLIEFKLTTLAGFVLI
PFALFNKTAFLAEKVLGNIVASGVKILVLSVIVGIGSGLFSEFTSGFSGTPTITDALALV
LGALSLMGLSIFGPGIATGLVSGAPQLGAGAAVGTGLAAAGIGAAGVMGAGAALGGGAAA
IGAAGHMTAAAARGGAHLAGATSGAYSGGASGHAGMGAVAGGLGGVAKAGASAAIQPVRQ
AASRAAASLKSTYAAGRAATTGGQTSPTGAGASASQSPSASGAPPAWATRMKRS

BLAST