GenomeNet

>tr:Q47VZ6_COLP3 [Q47VZ6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAZ24163.1};
MFYFSITNGIDMTIKRLFLFIVFTFKVQLLSFILVSTAHAQAASEQAVLSNQVQQLLKVD
NEMIDADIVKSLSEKIINNRHDYSNDILAKVYLLSAKVASNQGNMNNVFEFTKRGLAANS
LDKKIKLALLFKLADVYVARKEYKQLLEVTEEAVRNSEFSRSVKCRLLSLSYRSVAFAML
GKHQQALADLQQVELGISSSELTEHIQLLTILALAYHHLGDYQTSLTMQLKILKLRFEMN
QKRNIAQTYLYLGYAYFYLQRFDDAYNVFWESKKSAEGNNAPINVAHADKWLGIVLMRQK
QFHAALEPLQQAIEVFHQHNMLSERIETSVALVSAKLGVEQITEGYALLNEVVRLLNGKN
IASEYTGFYRMVAEMHFSQENYRLAYDWRKKYSQILLDNLNDKRKSFSIMQGLSHLAVGK
TPKIEPVEESKRLAVKLAESSELSSSFIGKYEKQRIIIISLSVLVALLILTLVGLFLRSR
AQKINRAYQELEKPSHSMASPMQTKFTYQLAFKKARKFRYPFHVGYLVVENWQELVFHFN
SKTISEVTKGLASVINEHIAEFDYVGLLNEGEYLLLFEHQSSQEVNEKLDKLVQAVNTRA
FANLGDFSVTMKYSLNMAGFKDIDPYLFLARIDESVNIAQVNPSKAP

BLAST