GenomeNet

>sp:SET5_USTMA [Q4PBP5] RecName: Full=Potential protein lysine methyltransferase SET5; EC=2.1.1.-; AltName: Full=SET domain-containing protein 5;
MVAPSETQIVQAVKAKLESGLTSTSDVVREDEVRRLLATLELEHDWQDIAVKKFISILCK
HSLMPVSKPNDGCTSRSTSCPGGKKKKKSKTDTSIPKSFIDPTISFPAGIRGVYFDPVKG
KGLVATRSFSKGDLLFTEDAYIPTPPPEAFDQMASGQLCAQCFLPISSAPVALAIKNCSK
CKHRFCTTACYKTAMATHHTLLCTGINASAKPLIELIERQKWQSLHCVARSLARLLMTLT
RQYHGQANKKADTQDSVATYGDFETVYARLSSFATVSELERRSRNPGWTTEKASFESILV
EAHTALCNALDPYSSTRNANLEPFHVSADYLDSTRKPLIKDLFCLATFMKLVGRANINME
KFGGLYSLHSFLNHSCSPNLEIRHVPERAILSSMKVAAIALCDIHPDDELVISYIDPNTS
LARRQLLLYRDYCFGPCTCDKCTTQLGALGLVYDPAKHAVKAFLDSVAHKTRPDPDHTLP
PTSQDSTLEDQLRASLGF

BLAST