GenomeNet

>tr:Q4SPZ8_TETNG [Q4SPZ8] SubName: Full=Chromosome 7 SCAF14536, whole genome shotgun sequence {ECO:0000313|EMBL:CAF97284.1}; Flags: Fragment;
VQSSEKPQVYKVGIYGWRKRCLYLFVLLLMILILINLALTIWILKVMNFTIDGMGNLRIT
EKGLKLEGPSEFLKPLYAKEIQSKPGRPLFLQSSRNLSVNVVNGNNQLLTQLVTGSSGFQ
ARGKTFEVKSTSGKLLFSASEQEVVVGAERLRVMGE

BLAST