GenomeNet

>tr:Q6FWV3_CANGA [Q6FWV3] RecName: Full=RING-type domain-containing protein {ECO:0000259|Pfam:PF14634};
MPENQFSQPFVHYGVCHRRHSVEDPLWLTSCAHLLCQAHLTPTKVCGVCGTRDISCLRLT
NDKPLPNEVDAYFQPISGLVENMYNVCQFQYVGLLDQCNYYQKISITLKEKCNRQQQLLY
KAKQELDNIPRLKRRIDELESLLKEGNYGIKKSKDNWTHTKRSLPQTVDLTIENTDQEED
QNFIQKLKNNTGLRKITPKVAPNNISAESSSHKMSITPGIFAMAESTQLISNQTTTSSVN
NNQLKFKTNIHRSPSSNIMTKDSQPSNQIMPQVLNKLTMLKRNNTVSTSNLEKSNTQMAT
HRSYLGTYNHPNSTMLLNRRRANSQQQPKSSKQSNFEMLRRVPSSNKNGR

BLAST