GenomeNet

>tr:Q6IMH6_MOUSE [Q6IMH6] SubName: Full=A disintegrin and metallopeptidase domain 26B {ECO:0000313|Ensembl:ENSMUSP00000079032}; SubName: Full=ADAM26b {ECO:0000313|EMBL:DAA01539.1};
MFLKFCLWTMFFFSAWSPIGHAKYSSLPEVVTPLRVTVTRGNNTSPGWLSYSLNIGGQRH
IITMKPKKNLMSRNLILLTYTQQGDLLEQRPFVPNDCYYHGYVDEDPESLVILNTCFGSL
QGTLEINGTTYEIMPKSSTSTFEHLAYKMDNGDSEPSPMRCGLSEEEIAQQRKLRERNAP
TLLQIPHENWWTHHRFIEYFVVIDHKQYVHRNNNITTCIQDMLQIVNGVNGYYLQIDTDV
VLTALEIWNEKNYINVELSIFKVLGDFCTWKQNMFGNRIRHDIIHLLVRQGYGLYLGLAY
LADVCTPYNCGVSSFLSDVMSDMAHIVAHEMGHNLGMKHDGIGCTCGLKDCLMAPYKTNS
PKFSNCSYEEMYSVVTKRSCLYDIPEALVTNLTVCGNKVVEEGEECDCGSTESCLQDPCC
SSDCVLKPGAQCAFGLCCQDCQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGI
PCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCGNDSSKYKICE
LADVLCGRIQCENVIQLPQRRNHETVHYTHFSNVTCWTMDYHFGITIDDIGAVSDGTACA
PYHICVDRKCVSKSDLVSNCTTKLCHMQGVCNNKNHCHCTNTWEPPDCQLRGHGGSLDSG
PPPLHVPNSSWAFYFISFFTILLVITISLVGITKRVKMN

BLAST