GenomeNet

>tr:Q6LJT0_PHOPR [Q6LJT0] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MSDFGVWMEENQGNTNINELDTPKEVTDLDNFLQNGEQQQNFQLSTSMKYGREADPERAG
RVFRQQLKTGLPSELIERNLDDIEKQSAEKDFDPVAFRNKSPLLSGWLQKPENAKVSHDD
LENLSTMEWLFRAPVEAYQDGADQVRLGGLRYKQMTSQLNDNELQFIDAYKKRGPRSYGA
DSWIGEAFVGATGQLSQFAPMIEEGLKYGVPAGLTAGTFALAAGQAGPQIALPEEIFTVP
GATALGLSSGFAYGKAKQSFELQTGLAYDEFKDFKDINGHPLDDDVAKGAAFFAGAFNAG
LDFVALDKLIETIPGAKNIMSGGATAVIKQALKNPTVTEGLKRFSTEYGKSVSAQVMIDA
GQELVQMIAGETAKRYQGNFENSDMVAIGDRMVEALDASLKANVVLSAPGHSMTLTGDLL
KSRQAQQNKQIMQQLGNSTQQSKLHARAPEKVRELMATVKENGPVQDVMIPVEQWNTLFQ
SESVDPLSMAAEILGDDGMQYREAAATGSDIMIPLDVYTEKLAGSQYHNMLLDDMRFEPD
QMTAREAAAWDASNQQNIEQQAASIADFITQPDETQFIFDDIVGQLKNTGMEMGTAETNA
IQMQSFFRTLSSRTGIDAKKLWSQYGPKVTREMPEVLKSAGGNFDIAVDPILDRIRANDI
PELSDIQGKTMLETLREKGIQDVGGELSARDVDVKLKPFQKKLISESGVTLDDAAQLMAE
AGYIPADIDSVTQNDLLEAIDREMAGDPVYSQLNENAKALEDRETLLSMSGYLEDLGIDV
SQVSNQDIKQQLSNQIANEGDGVTLNQAERGEIKISQDKKFQITFFKNADLSTLLHESGH
MYFEILQDIDKKGMASESISNDLKTVRDWVGAKDGKDITTEQHEQFARGFEQYLREGKAP
TTELQSAFARFRAWLVTIYRQASKLNVDVSEDVRQVFDRMLATDDQIKAAETQMEYNRLF
EDAESAGMTEAEFNRYQKDATLAREQAQEEVTVKAFNEMQREQKKWWKDAEIDMRDQVMA
EMAENPTYQAVNYLQKGKLLDMDLPEGVEALKLSKNALVEKYGKQFLKLLPRPYIYTKTG
GAHPDQIAVLFGFSSGDEMMQLIVNARPMKDVVNAEVDTRMRQQYGDMMNDGTLPETAMD
AAHNDRRASVLAAELKALSRRVSSRGAPTPAAMMKQAAQTVVDRKTVRSLKPSVYLNAER
KAAKQALEAVLAGDYAAAADAKQRQLLNFYMGNYTKKAKAETDKSRDYLNSFNRPKKRQA
LGKAGHDYLDQIDALLEKTEFKRVSLISLDRRKSLSEFIQNQEEQGWTVEIPESLVKQTQ
SRNWKDMTVEELTGLRDAVKNIDYLARFKNKLLRQDEKRKFEEIVDAAVSSIEANNVVHE
IKPNFAETWKDRVKENVSGFMASHTKMEFFFEWLDGDSANGEAWRSFYKPINDADNKEKL
MQESYTKRLAGILDAYTSKERGKWYTDTSHIQHVGRVNKAMAMSVALNWGNVGNQQAVLD
GYTRNDGKNWTETEAQRILEMLDQKDWDTIQKVWDLINDLWPEISKLQKDLTGVSPEKVE
ASLIQTKYGEIKGGYYPLVYDQKLSYAVFKRDEKAATQDLFESNFSKPATKKGHTIERTG
SGGQAVKLDLSVISEHIDNVIHDITHRRALMDTDRLIQNPRVRAAIEKTAGRQMYRQLRP
WLQSIAREQQPTFNYVETLIGKARTGATVVNMGLKVTTAIAQPLGVLNSVDELGVISMMK
GIKDFYANSPVGMKKRLDFVTSRSAMMRNRQKTFDRDIKDAAKRLGKDKKFDKVRESFFY
LTGLLDMGVSVPTWLAAYRKALDGNVDGITAGDENTAIDFADRTVRVTQSEGGAKDLAKI
QRGGEVFRSFTMFYSYFSVLHNQLRKRGRQYVRGDTNTSQLAASMFFLWFAPAVLGELVA
GRGPGDDEDWDKWALKEISSYPFQTVVFVRDLVNGLGDFGYSASPAFDAFEMSVKAVKLP
YKAIAPDEEVKRSDVKAAVLAAGYWGQLPSRQAWITGEYVYDMMTGEEKPEDGFEMMRNL
MLTRPRD

BLAST