GenomeNet

>tr:Q726W8_DESVH [Q726W8] SubName: Full=Phage shock protein A {ECO:0000313|EMBL:AAS97459.1};
MGIFSRFKDIVSSNINAMLDRAEDPEKLIRLMIREMEETLVELKAACARTMAECRRLGRE
GEEAERQVSLWDRRAELALDSGREDLAREALLERRRATEHVEALTRETEECEALVARTQE
DMDVLEQKLVTAREKQRLLAQRHVHARARRQAREESRRAASFDVMERFETMERRVEHMEA
EADAVRVPRSGGAGGVFADLETRDAIERDLAALRQRMGRDG

BLAST