GenomeNet

>sp:RAPB_DICDI [Q86L51] RecName: Full=Ras-related protein rapB; Flags: Precursor;
MGKGNGKSKDSKGSEKSSTKTKFFVAVMGAGSVGKSALTVQFTQGVFIDKYDPTVEDTYT
KTFELDGEQVCIEVLDTAGSEVLVAMRELYMKNAEGFILVYSILVKSTFLEIKDIVEQLF
RVKEEEEVPIVLVGNKIDLDAHREVSTNEGKQLANSYPNCDFWEASSKDRINVDNVFFSI
VKRIKEKYKKEGAPVKEKKEKCIIM

BLAST