GenomeNet

>sp:CDC26_HUMAN [Q8NHZ8] RecName: Full=Anaphase-promoting complex subunit CDC26; AltName: Full=Anaphase-promoting complex subunit 12; Short=APC12; AltName: Full=Cell division cycle protein 26 homolog;
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF

BLAST