GenomeNet

>sp:APC16_HUMAN [Q96DE5] RecName: Full=Anaphase-promoting complex subunit 16; Short=APC16; AltName: Full=Cyclosome subunit 16;
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG

BLAST