GenomeNet

>sp:GALT9_MACFA [Q9GM01] RecName: Full=Polypeptide N-acetylgalactosaminyltransferase 9; EC=2.4.1.41 {ECO:0000250|UniProtKB:Q9HCQ5}; AltName: Full=Polypeptide GalNAc transferase 9; Short=GalNAc-T9; Short=pp-GaNTase 9; AltName: Full=Protein-UDP acetylgalactosaminyltransferase 9; AltName: Full=UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9;
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRPLSGGCRPRPATPAPGSPLRS
GGPRAVVAGRAELVLKGQLPAEPCSPGRLMVPEAEAEAQGGLAATLRDDGQEAEGKYEEY
GYNAQLSDRISLDRSIPDYRPRKCRHMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNH
TPSQLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAAT
APVVGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWG
LWCMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELG
MRVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWN
IPMTNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYC
LDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTL
RKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNW
IKHARH

BLAST